PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.4093s0028.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family TALE
Protein Properties Length: 467aa    MW: 53274.9 Da    PI: 6.3058
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.4093s0028.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.52.3e-083844221854
                          HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          +F++  ++yp+ +e+  LA + gLt +qV++WF N R +
  Cagra.4093s0028.1.p 384 MFQNflHPYPKDSEKHLLAIRSGLTRSQVSNWFINARVR 422
                          5887779******************************88 PP

2BELL90.91.3e-29259329172
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          +r++l+++k++Ll+ll++Vd+rY+++v++++tv+s+F+a+++l++ +++t++Al++iS+ +++L+++i+++i
  Cagra.4093s0028.1.p 259 QRRALESQKTHLLDLLQMVDDRYSHCVDEIHTVVSAFHAATELDP-QLHTRFALQTISFLYKNLRERICKKI 329
                          6899*****************************************.************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.7E-59189327IPR006563POX domain
PfamPF075262.2E-28195325IPR006563POX domain
PROSITE profilePS5007110.981363426IPR001356Homeobox domain
CDDcd000861.10E-9366427No hitNo description
SMARTSM003897.1E-5366430IPR001356Homeobox domain
SuperFamilySSF466895.99E-15367435IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-25369432IPR009057Homeodomain-like
PfamPF059201.5E-14383422IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    Send to blast
MDNDNTFTSL DNVMANQNPL LMDFIPSRED STPFSTMLPW NSIRSDPLQM AGFDFFNSML  60
TNKYLSSSSR SFDDVQENRN VQSFEVMAPP PPPPLDHFRP YDDSSNNLWG FEGNSEFQTY  120
SGVVGPSEPM MSTFGEEDFP FLISNKRNNE LSLSLATDVS DECSEISLCG ATKLASEQAS  180
CSSKDISTQS FSQLIFGSKY LHSVQEILSH FASYSLDYSS RGTESAAASS AFHSRFENLT  240
EFLDDDSNNS EAEFGSTLQR RALESQKTHL LDLLQMVDDR YSHCVDEIHT VVSAFHAATE  300
LDPQLHTRFA LQTISFLYKN LRERICKKIL AMGSVLERGK DKSQENSMFH QHCLLQQLKR  360
KNHQIWRPQR GLPEKSVSVL RTWMFQNFLH PYPKDSEKHL LAIRSGLTRS QVSNWFINAR  420
VRLWKPMIEE MYAEMNKRKL NNSHLQPNGA TLRMPKSVMM SQAMHK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B6e-14372430563Homeobox protein Meis2
3k2a_A6e-14372430563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0721740.0AY072174.1 Arabidopsis thaliana putative homeobox gene ATH1 protein (At4g32980) mRNA, complete cds.
GenBankAY0965130.0AY096513.1 Arabidopsis thaliana putative homeobox gene ATH1 protein (At4g32980) mRNA, complete cds.
GenBankX801260.0X80126.1 A.thaliana AtH1 mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006283680.10.0hypothetical protein CARUB_v10004743mg
SwissprotP487310.0ATH1_ARATH; Homeobox protein ATH1
TrEMBLR0GZK70.0R0GZK7_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.7__829__AT4G32980.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM82282637
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.10.0homeobox gene 1